PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0058s0105.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 343aa    MW: 38580.1 Da    PI: 7.0024
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0058s0105.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.29.6e-18228262135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Kaladp0058s0105.1.p 228 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 262
                          99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.2E-7219318IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.492222258IPR000679Zinc finger, GATA-type
SMARTSM004011.5E-16222272IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.6E-14223259IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.0E-15224286No hitNo description
CDDcd002027.46E-14227274No hitNo description
PROSITE patternPS003440228253IPR000679Zinc finger, GATA-type
PfamPF003201.2E-15228262IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MEALDFYQTG FCYRSGAPEK RLPNVDPIKQ EPFVVEEFLD FSNDEDHVAM ADVKLTPPAF  60
DGCHGLNSAE SSSVTAVDSC NGCNENSFSE PHVMGEIGQR SLLDRSFAGE LCVPHDDLAE  120
LEWLSTLQEE SFSSEDMQNL QLISGMAARA DIEPNKPNSS FRPEMPVPGK ARSKRSRAAP  180
GNWASHLLVL SPTTSTSENE RPLSPKTVTK RKDGRDRDRH APSDGRKCLH CATDKTPQWR  240
TGPMGPKTLC NACGVRYKSG RLVPEYRPAA SPTFVLTKHS NSHRKVLELR RQKEMHHRQP  300
QPHHLHHHHQ HHFLHQSLIY DMSNGEDYLI HQHTGPDYRQ LI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010267189.11e-133PREDICTED: GATA transcription factor 12-like
SwissprotP697811e-83GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A061GK481e-118A0A061GK48_THECC; GATA transcription factor 9, putative
STRINGVIT_04s0008g03270.t011e-116(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.15e-85GATA transcription factor 12